Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT0BI4Q)
DTT Name | Epstein-Barr virus Latent membrane protein 1 (EBV LMP1) | ||||
---|---|---|---|---|---|
Synonyms | Protein p63; P63; Latent membrane protein 1; LMP1; LMP-1; BNLF1 | ||||
Gene Name | EBV LMP1 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
Sequence |
MERDLERGPPGPPRPPLGPPLSSSIGLALLLLLLALLFWLYIVLSNWTGGALLVLYSFAL
MLIIIILIIFIFRRDLLCPLGGLGLLLLMVTLLLIALWNLHGQALYLGIVLFIFGCLLVL GLWIYFLEILWRLGATIWQLLAFILAFFLAIILLIIALYLQQNWWTLLVDLLWLLLFMAI LIWMYFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQ NLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNP SDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPV QLSYYD |
||||
Function |
Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses. Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
References