Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT0F26C)
DTT Name | Cytochrome c oxidase copper chaperone (COX17) | ||||
---|---|---|---|---|---|
Synonyms | Cytochrome c oxidase assembly protein COX17; COX17; CCO assembly protein COX17 | ||||
Gene Name | COX17 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG
FKI |
||||
Function | Copper chaperone for cytochromec oxidase (COX). Binds two copper ions and deliver them to the Cu(A) site of COX. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||