Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT0JTFD)

• DTT Name: Interleukin-9 (IL9)
• Synonyms: T-cell growth factor P40; P40 cytokine; IL-9; Cytokine P40
• Gene Name: IL9
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine: interleukin
• UniProt ID: IL9_HUMAN
• TTD ID: T67079
• Sequence:
  MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIP
  SDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGN
  ALTFLKSLLEIFQKEKMRGMRGKI
• Function: Supports IL-2 independent and IL-4 independent growth of helper T-cells.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Jak-STAT signaling pathway (hsa04630)
  Asthma (hsa05310)
• Reactome Pathway: Interleukin-9 signaling (R-HSA-8985947)

Molecular Interaction Atlas (MIA) of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BNZ-1	DM8JQZC	Cutaneous T-cell lymphoma	2B01	Phase 2	[2]
MEDI-528	DMDYVN8	Asthma	CA23	Phase 2	[1]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	8.78E-01	-0.03	-0.09

References

• [1] Clinical pipeline report, company report or official report of AstraZeneca (2009).
• [2] Clinical pipeline report, company report or official report of Bioniz Therapeutics.