Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT0KV32)
| DTT Name | Transcobalamin receptor (CD320) | ||||
|---|---|---|---|---|---|
| Synonyms | UNQ198/PRO224; TCblR; FDCsignaling molecule 8D6; FDCSM8D6; FDC-signaling molecule 8D6; FDC-SM-8D6; CD320 antigen; 8D6A; 8D6 antigen | ||||
| Gene Name | CD320 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQ
CRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGT DKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATT MGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSA SLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP |
||||
| Function |
Plays an important role in cobalamin uptake. Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and mediates interaction with germinal center B cells. Functions as costimulator to promote B cell responses to antigenic stimuli; promotes B cell differentiation and proliferation. Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for transcobalamin saturated with cobalamin (TCbl).
|
||||
| Reactome Pathway | |||||