Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT0NIZ1)

DTT Name	C-X-C motif chemokine 13 (CXCL13)
Synonyms	Smallinducible cytokine B13; Small-inducible cytokine B13; SCYB13; CXC chemokine BLC; BLC; BCA1; BCA-1; B lymphocyte chemoattractant; B cellattracting chemokine 1; B cell-attracting chemokine 1; Angie
Gene Name	CXCL13
DTT Type	Literature-reported target	[1]
BioChemical Class	Cytokine: CXC chemokine
UniProt ID	CXL13_HUMAN
TTD ID	T27700
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Function	Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5. Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Viral protein interaction with cytokine and cytokine receptor (hsa04061 ) Chemokine signaling pathway (hsa04062 )
Reactome Pathway	G alpha (i) signalling events (R-HSA-418594 ) Chemokine receptors bind chemokines (R-HSA-380108 )

References

1	Chemokine (C-X-C motif) ligand 13 promotes intrahepatic chemokine (C-X-C motif) receptor 5+ lymphocyte homing and aberrant B-cell immune responses ... Hepatology. 2015 Jun;61(6):1998-2007.