Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT13GFV)
DTT Name | Follicle stimulating hormone (FSHB) | ||||
---|---|---|---|---|---|
Synonyms | Follitropin subunit beta; Follitropin beta chain; Follicle-stimulating hormone beta subunit; FSH-beta; FSH-B | ||||
Gene Name | FSHB | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Hormone
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP
ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS YCSFGEMKE |
||||
Function |
Together with the alpha chain CGA constitutes follitropin, the follicle-stimulating hormone, and provides its biological specificity to the hormone heterodimer. Binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||