Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT16NHT)

DTT Name Mutated Histone H3.3 (H3F3A)
Synonyms PP781; Histone H3.3; H3F3; H3.3B; H3.3A
Gene Name H3F3A
DTT Type
Literature-reported target
 [1]
UniProt ID
H33_HUMAN
TTD ID
T90766
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Function
Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
KEGG Pathway
Neutrophil extracellular trap formation (hsa04613 )
Alcoholism (hsa05034 )
Shigellosis (hsa05131 )
Transcriptional misregulation in cancer (hsa05202 )
Systemic lupus erythematosus (hsa05322 )
Reactome Pathway
Formation of the beta-catenin (R-HSA-201722 )
PRC2 methylates histones and DNA (R-HSA-212300 )
Condensation of Prophase Chromosomes (R-HSA-2299718 )
Oxidative Stress Induced Senescence (R-HSA-2559580 )
Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
SIRT1 negatively regulates rRNA expression (R-HSA-427359 )
ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression (R-HSA-427389 )
NoRC negatively regulates rRNA expression (R-HSA-427413 )
B-WICH complex positively regulates rRNA expression (R-HSA-5250924 )
DNA methylation (R-HSA-5334118 )
Transcriptional regulation by small RNAs (R-HSA-5578749 )
Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )
Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 (R-HSA-5625886 )
Assembly of the ORC complex at the origin of replication (R-HSA-68616 )
RNA Polymerase I Promoter Opening (R-HSA-73728 )
RNA Polymerase I Promoter Escape (R-HSA-73772 )
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function (R-HSA-8936459 )
RUNX1 regulates transcription of genes involved in differentiation of HSCs (R-HSA-8939236 )
Estrogen-dependent gene expression (R-HSA-9018519 )
Meiotic recombination (R-HSA-912446 )
Transcriptional regulation of granulopoiesis (R-HSA-9616222 )
Inhibition of DNA recombination at telomere (R-HSA-9670095 )
Defective pyroptosis (R-HSA-9710421 )
Amyloid fiber formation (R-HSA-977225 )
Factors involved in megakaryocyte development and platelet production (R-HSA-983231 )
Pre-NOTCH Transcription and Translation (R-HSA-1912408 )

References

1 K27M-mutant histone-3 as a novel target for glioma immunotherapy. Oncoimmunology. 2017 May 12;6(7):e1328340.