Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT16TM5)

DTT Name	N-formyl peptide receptor 3 (FPR3)
Synonyms	Formyl peptide receptor-like 2; FPRL2; FPRH1; FMLP-related receptor II; FMLP-R-II
Gene Name	FPR3
DTT Type	Literature-reported target	[1]
UniProt ID	FPR3_HUMAN
TTD ID	T25705
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA LDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNF AFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPL RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
Function	Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
KEGG Pathway	Neuroactive ligand-receptor interaction (hsa04080 ) Neutrophil extracellular trap formation (hsa04613 ) Staphylococcus aureus infection (hsa05150 )
Reactome Pathway	Formyl peptide receptors bind formyl peptides and many other ligands (R-HSA-444473 ) G alpha (i) signalling events (R-HSA-418594 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
humanin	DMUAPNF	Alzheimer disease	8A20	Preclinical	[1]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LXA4	DMGSVL0	Discovery agent	N.A.	Investigative	[2]
------------------------------------------------------------------------------------

References

1	N-Formylated humanin activates both formyl peptide receptor-like 1 and 2. Biochem Biophys Res Commun. 2004 Nov 5;324(1):255-61.
2	Aspirin-triggered 15-epi-lipoxin A4 (LXA4) and LXA4 stable analogues are potent inhibitors of acute inflammation: evidence for anti-inflammatory receptors. J Exp Med. 1997 May 5;185(9):1693-704.