Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT1BGU8)

DTT Name	Phosphatidylethanolamine-binding protein 1 (PEBP1)
Synonyms	Raf kinase inhibitor protein; RKIP; Prostatic-binding protein; PEBP-1; PEBP; PBP; Neuropolypeptide h3; Hippocampal cholinergic neurostimulating peptide; HCNPpp; HCNP
Gene Name	PEBP1
DTT Type	Literature-reported target	[1]
BioChemical Class	Phosphatidylethanolamine-binding protein family
UniProt ID	PEBP1_HUMAN
TTD ID	T93904
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDS GKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRY VWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKL YEQLSGK
Function	Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase. Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation.
Reactome Pathway	Negative regulation of MAPK pathway (R-HSA-5675221 ) Signaling by moderate kinase activity BRAF mutants (R-HSA-6802946 ) Signaling by high-kinase activity BRAF mutants (R-HSA-6802948 ) Signaling by BRAF and RAF1 fusions (R-HSA-6802952 ) Paradoxical activation of RAF signaling by kinase inactive BRAF (R-HSA-6802955 ) Signaling downstream of RAS mutants (R-HSA-9649948 ) MAP2K and MAPK activation (R-HSA-5674135 )

References

1	Phosphatidylethanolamine-binding protein 1 (PEBP1) as a potential target for the treatment for depression. CNS Neurosci Ther. 2013 Dec;19(12):982-3.