Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT1C9K6)

• DTT Name: Delta-like protein 3 (DLL3)
• Synonyms: pudgy; pu; delta like canonical Notch ligand 3; SCDO1; Drosophila Delta homolog 3; Delta3
• Gene Name: DLL3
• DTT Type: Clinical trial target; [1]
• UniProt ID: DLL3_HUMAN
• TTD ID: T75716
• Sequence:
  MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
  RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
  SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
  PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
  EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC
  PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
  PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
  FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
  PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL
  PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA
  GQRQHLLFPYPSSILSVK
• Function: May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm. Inhibits primary neurogenesis.
• KEGG Pathway:
  Endocrine resistance (hsa01522)
  Notch signaling pathway (hsa04330)
  Th1 and Th2 cell differentiation (hsa04658)
  Pathways in cancer (hsa05200)
  Breast cancer (hsa05224)

Molecular Interaction Atlas (MIA) of This DTT

6 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Rova-T	DMNGCAD	Small-cell lung cancer	2C25.Y	Phase 3	[1]
Tarlatamab	DME33OU	Small-cell lung cancer	2C25.Y	Phase 2	[2]
HPN328	DM1ZHML	Small-cell lung cancer	2C25.Y	Phase 1/2	[3]
AMG 119	DMKF1O2	Small-cell lung cancer	2C25.Y	Phase 1	[4]
AMG 757	DMLYP2N	Neuroendocrine cancer	2B72.1	Phase 1	[4]
RG6524	DMT22UV	Aggressive cancer	2A00-2F9Z	Phase 1	[5]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [2] Tarlatamab, a First-in-Class DLL3-Targeted Bispecific T-Cell Engager, in Recurrent Small-Cell Lung Cancer: An Open-Label, Phase I Study. J Clin Oncol. 2023 Jun 1;41(16):2893-2903.
• [3] Clinical pipeline report, company report or official report of Harpoon Therapeutics.
• [4] Clinical pipeline report, company report or official report of Amgen.
• [5] Clinical pipeline report, company report or official report of Roche