Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT1ERKL)
DTT Name | CD40 messenger RNA (CD40 mRNA) | ||||
---|---|---|---|---|---|
Synonyms | Tumor necrosis factor receptor superfamily member 5 (mRNA); TNFRSF5 (mRNA); CDw40 (mRNA); CD40L receptor (mRNA); Bp50 (mRNA); B-cell surfaceantigen CD40 (mRNA); B-cell surface antigen CD40 (mRNA) | ||||
Gene Name | CD40 | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
mRNA target
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ |
||||
Function | Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. Receptor for TNFSF5/CD40LG. | ||||
KEGG Pathway |
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
8 Investigative Drug(s) Targeting This DTT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||