Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT1OCL0)

DTT Name	Ghrelin (GHRL)
Synonyms	UNQ524/PRO1066; Motilin-related peptide; M46 protein; Growth hormone secretagogue; Growth hormone releasing peptide; Gastric peptide ghrelin; GHRL
Gene Name	GHRL
DTT Type	Clinical trial target	[1]
UniProt ID	GHRL_HUMAN
TTD ID	T06850
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Function	Specific ligand for the growth hormone secretagogue receptor type 1 (ghsr) inducing the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion.Involved in growth regulation.
KEGG Pathway	cAMP signaling pathway (hsa04024 )
Reactome Pathway	G alpha (q) signalling events (R-HSA-416476 ) Synthesis, secretion, and deacylation of Ghrelin (R-HSA-422085 ) Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Unacylated ghrelin	DMI5UEB	Type-1 diabetes	5A10	Phase 1	[2]
------------------------------------------------------------------------------------

References

1	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
2	Alize Pharma signs research collaboration and license option agreement with Lilly. Lyon, France, January 25, 2010.