Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT23XQV)

DTT Name PD-1-PD-L1 interaction (PD-1/PD-L1 PPI)
Synonyms Programmed cell death 1/Programmed cell death 1 ligand 1 PPI
Gene Name PDCD1-CD274
DTT Type
Patented-recorded target
 [1]
UniProt ID
PDCD1_HUMAN-PD1L1_HUMAN
TTD ID
T13629
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEETMQIPQAPWPV
VWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM
SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAP
KAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAV
ICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYAT
IVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
Function
The PD-1/PD-L1 axis is probably also important for immune evasion of B-cell lymphomas with a viral aetiology, including those associated with human immunodeficiency virus (HIV) and Epstein-Barr virus (EBV).

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
73 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,2,4-oxadiazole derivative 4 DMT6EDP Hepatitis DB97.Z Patented [1]
1,2,4-oxadiazole derivative 5 DM683R7 Hepatitis DB97.Z Patented [1]
1,2,4-oxadiazole derivative 6 DMFYKBJ Hepatitis DB97.Z Patented [1]
1,2,4-oxadiazole derivative 7 DMBT4RJ Hepatitis DB97.Z Patented [1]
1,3,4-oxadiazole derivative 3 DMSR0X6 Hepatitis DB97.Z Patented [1]
1,3,4-oxadiazole derivative 4 DM4GR2C Hepatitis DB97.Z Patented [1]
1,3,4-oxadiazole derivative 5 DMI5VZN Hepatitis DB97.Z Patented [1]
1,3,4-oxadiazole derivative 6 DMIEZ6L Hepatitis DB97.Z Patented [1]
1,3,4-thiadiazole derivative 1 DMAB8QF Hepatitis DB97.Z Patented [1]
1,3,4-thiadiazole derivative 2 DMXIG07 Hepatitis DB97.Z Patented [1]
1,3-dihydroxy phenyl derivative 1 DMUS7O3 Hepatitis DB97.Z Patented [1]
1,3-dihydroxy phenyl derivative 2 DM63NX5 Hepatitis DB97.Z Patented [1]
3-substituted-1,2,4-oxadiazole derivative 1 DMWCT04 Hepatitis DB97.Z Patented [1]
3-substituted-1,2,4-oxadiazole derivative 2 DMB3806 Hepatitis DB97.Z Patented [1]
Aromatic acetylene derivative 1 DMGR6X1 Hepatitis DB97.Z Patented [1]
Aromatic ethylene derivative 1 DMSRKON Hepatitis DB97.Z Patented [1]
Benzyl phenyl ether derivative 1 DM6PTOX Hepatitis DB97.Z Patented [1]
Benzyl phenyl ether derivative 2 DMMS4EI Hepatitis DB97.Z Patented [1]
Biaryl compound 1 DMHEAJQ Hepatitis DB97.Z Patented [1]
Biaryl compound 2 DMS8VYE Hepatitis DB97.Z Patented [1]
Bromo benzyl ether derivative 1 DMMXQJU Hepatitis DB97.Z Patented [1]
Bromo benzyl ether derivative 2 DMVBAUC Hepatitis DB97.Z Patented [1]
Cyclic peptidomimetic derivative 1 DMV2UQ5 Hepatitis DB97.Z Patented [1]
Cyclic peptidomimetic derivative 2 DMWH3FP Hepatitis DB97.Z Patented [1]
Cyclic peptidomimetic derivative 3 DMI7KG4 Hepatitis DB97.Z Patented [1]
Macrocycle derivative 1 DMN7I9C Hepatitis DB97.Z Patented [1]
Macrocycle derivative 2 DM5OEQZ Hepatitis DB97.Z Patented [1]
Macrocycle derivative 3 DMYGFTI Hepatitis DB97.Z Patented [1]
Macrocycle derivative 4 DMOQBN4 Hepatitis DB97.Z Patented [1]
Macrocycle derivative 5 DMK3UJY Hepatitis DB97.Z Patented [1]
Macrocycle derivative 6 DMQ84KW Hepatitis DB97.Z Patented [1]
Macrocycle derivative 7 DMP2JF0 Hepatitis DB97.Z Patented [1]
Macrocycle derivative 8 DMOMTBE Hepatitis DB97.Z Patented [1]
Macrocycle derivative 9 DMARU0E Hepatitis DB97.Z Patented [1]
Macrocyclic peptide analog 1 DMS65IT Hepatitis DB97.Z Patented [1]
Macrocyclic peptide analog 2 DMOGLBZ Hepatitis DB97.Z Patented [1]
Macrocyclic peptide analog 3 DMV172W Hepatitis DB97.Z Patented [1]
N-phenyl-pyridine-2-carboxamide derivative 1 DMMDYAV Hepatitis DB97.Z Patented [1]
N-phenyl-pyridine-2-carboxamide derivative 2 DM6OG2Y Hepatitis DB97.Z Patented [1]
Peptide analog 1 DMF3LIX Hepatitis DB97.Z Patented [1]
Peptide analog 2 DMYFUM6 Hepatitis DB97.Z Patented [1]
Peptide analog 3 DMYMJV3 Hepatitis DB97.Z Patented [1]
Peptide analog 4 DM5KEVG Hepatitis DB97.Z Patented [1]
Peptide analog 5 DM8B13I Hepatitis DB97.Z Patented [1]
Peptide analog 6 DM68M0G Hepatitis DB97.Z Patented [1]
Phenylate derivative 1 DMEO9QB Hepatitis DB97.Z Patented [1]
Phenylate derivative 2 DMG0ZSY Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example11 DMD65GU Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example12 DMN2K10 Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example13 DM4CN9K Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example14 DMAUFS7 Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example3 DMDCN43 Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example4 DMRKLTE Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example41 DMQPIK4 Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example42 DM95FIN Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example43 DMJSH0F Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example44 DM8KAIY Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example45 DMC075A Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example46 DMYFSAD Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example47 DM1TCBQ Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example48 DMH57FG Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example49 DM4D1WK Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example50 DMV15GM Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example51 DM08CBJ Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example52 DMJ1C0A Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example53 DM39FDV Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example54 DM9DL1E Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example57 DMZXC0D Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example58 DM3AY9K Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example59 DM6XWL9 Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example60 DMUZ85A Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example7 DMS42KH Hepatitis DB97.Z Patented [1]
PMID30107136-Compound-Example8 DMBIK28 Hepatitis DB97.Z Patented [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 73 Patented Agent(s)
1 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
MAX-10129 DM1XYGF N. A. N. A. Preclinical [2]
------------------------------------------------------------------------------------
23 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PMID30247903-Compound-General structure18 DMZBQ5R N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure19 DM8LS3I N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure26 DM4BF1P N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure27 DMYSWO4 N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure28 DMALSIW N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure29 DM9FEB6 N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure30 DMHQ1ZD N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure31 DMSLWBI N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure32 DMD04TR N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure33 DMFLQ96 N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure34 DM1YOVG N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure35 DMF9HIJ N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure36 DMI4EU5 N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure37 DMDWHIN N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure38 DMDB9FT N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure39 DMKLATO N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure40 DMPZ3AY N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure41 DM0UMSF N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure42 DMRNF96 N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure43 DMY971M N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure44 DMRAFSB N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure45 DMHMUNB N. A. N. A. Investigative [2]
PMID30247903-Compound-General structure46 DMWYCOB N. A. N. A. Investigative [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 23 Investigative Drug(s)

References

1 A patent review on PD-1/PD-L1 antagonists: small molecules, peptides, and macrocycles (2015-2018).Expert Opin Ther Pat. 2018 Sep;28(9):665-678.
2 Development of Inhibitors of the Programmed Cell Death-1/Programmed Cell Death-Ligand 1 Signaling Pathway.J Med Chem. 2019 Feb 28;62(4):1715-1730.