Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT2F4OL)

• DTT Name: Tissue transglutaminase (TG2)
• Synonyms: Transglutaminase-2; Transglutaminase H; Transglutaminase C; Transglutaminase 2; Tranglutaminase 2; TTg; TGase-H; TGase-2; TGase H; TGase C; TGC; TG(C)Protein-glutamine gamma-glutamyltransferase; TG(C); Protein-glutamine gamma-glutamyltransferase 2
• Gene Name: TGM2
• DTT Type: Preclinical target; [1]
• BioChemical Class: Acyltransferase
• UniProt ID: TGM2_HUMAN
• TTD ID: T05387
• EC Number: EC 2.3.2.13
• Sequence:
  MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
  VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
  ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
  NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
  WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
  YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
  PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
  IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
  QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
  SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
  RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
  LHKLVVNFESDKLKAVKGFRNVIIGPA
• Function: Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins.
• KEGG Pathway: Huntington's disease (hsa05016)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ZED1227	DMDXEN5	Coeliac disease	DA95	Phase 2	[2]

53 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2-alkyloxy-3-phenylethynyl-4a,5-dihydropyrido[2,3-b]pyrazine derivative 1	DMMFZKC	N. A.	N. A.	Patented	[1]
3-acylidene-2-oxoindole derivative 1	DM8L0MN	N. A.	N. A.	Patented	[1]
3-acylidene-2-oxoindole derivative 2	DMJ98VG	N. A.	N. A.	Patented	[1]
Acyl piperidine derivative 2	DM2FUIB	N. A.	N. A.	Patented	[1]
Acyl piperidine derivative 3	DMIDUB4	N. A.	N. A.	Patented	[1]
Azachalcone derivative 1	DMVD5TA	N. A.	N. A.	Patented	[1]
Benzotriazole derivative 1	DMCO0ZS	N. A.	N. A.	Patented	[1]
Chalcone derivative 5	DMJZGT8	N. A.	N. A.	Patented	[1]
Chloroacetyl ester derivative 1	DMW4J0P	N. A.	N. A.	Patented	[1]
Dihydroisoxazole derivative 1	DMQRECT	N. A.	N. A.	Patented	[1]
Dihydroisoxazole derivative 2	DMLTZKX	N. A.	N. A.	Patented	[1]
Dipeptide analog 2	DMMAF2S	N. A.	N. A.	Patented	[1]
Dipeptide analog 3	DM6RLTV	N. A.	N. A.	Patented	[1]
Dipeptide analog 4	DMXOPIJ	N. A.	N. A.	Patented	[1]
Isothiocyanate derivative 1	DMK31M6	N. A.	N. A.	Patented	[1]
Peptide analog 52	DMDG5T9	N. A.	N. A.	Patented	[1]
Peptide analog 53	DM9FJXS	N. A.	N. A.	Patented	[1]
Peptide analog 54	DMZVB5U	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-1	DMSI7F2	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-11	DMZ5UST	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-12	DMA8JGP	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-13	DMKF26Z	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-14	DM52MIK	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-15	DM1ZSEI	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-16	DM8UI4Z	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-17	DMITU83	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-18	DMK39S5	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-2	DMC7AXQ	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-23	DMDS2CU	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-24	DMWCM2I	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-25	DMZ43OM	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-26	DMVEQ2P	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-27	DM8WP3D	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-3	DM92OT0	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-31	DM74GUB	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-32	DM2QWXF	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-33	DMUL84D	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-34	DMLGZPO	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-35	DMO36RL	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-4	DMEZLBQ	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-46	DMTOJCG	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-47	DMWC1IY	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-48	DMXV0CK	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-49	DMST6C2	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-5	DM6G2WJ	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-50	DMHZ8N1	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-54	DM2X4R0	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-6	DMMHL2C	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-7	DMRAXD1	N. A.	N. A.	Patented	[1]
PMID26560530-Compound-8	DMN6TG7	N. A.	N. A.	Patented	[1]
Pyrazolodiazepine derivative 1	DMRN2QI	N. A.	N. A.	Patented	[1]
Sulfonamide derivative 9	DM2RZL8	N. A.	N. A.	Patented	[1]
Triazole derivative 1	DM9QB2S	N. A.	N. A.	Patented	[1]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NTU281	DM65UZ2	Renal fibrosis	GC01	Preclinical	[3]

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Guanosine-5'-Diphosphate	DM0MUKQ	Discovery agent	N.A.	Investigative	[4]

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Transglutaminase H (TGM2) DME Info
• Gene Name: TGM2

References

• [1] Transglutaminase inhibitors: a patent review.Expert Opin Ther Pat. 2016;26(1):49-63.
• [2] Features of ZED1227: The First-In-Class Tissue Transglutaminase Inhibitor Undergoing Clinical Evaluation for the Treatment of Celiac Disease. Cells. 2022 May 17;11(10):1667.
• [3] Drugs and Targets in Fibrosis. Front Pharmacol. 2017 Nov 23;8:855.
• [4] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.