Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT2GM5R)

• DTT Name: Lymphocyte activation antigen CD30 (TNFRSF8)
• Synonyms: Tumor necrosis factor receptor superfamily member 8; KI-1 antigen; D1S166E; CD30L receptor; CD30
• Gene Name: TNFRSF8
• DTT Type: Successful target; [1]
• UniProt ID: TNR8_HUMAN
• TTD ID: T88023
• Sequence:
  MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
  RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
  SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
  PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
  RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
  VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA
  SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
  HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL
  ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
  AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
• Function: May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B. Receptor for TNFSF8/CD30L.
• KEGG Pathway: Cytokine-cytokine receptor interaction (hsa04060)
• Reactome Pathway: TNFs bind their physiological receptors (R-HSA-5669034)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Brentuximab vedotin	DMWLC57	Hodgkin lymphoma	2B30	Approved	[1]

20 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AFM13	DMN45IC	Hodgkin lymphoma	2B30	Phase 2	[2]
CAR-T cells targeting CD30	DML0KWM	Non-hodgkin lymphoma	2B33.5	Phase 2	[3]
Iratumumab	DMI874B	Lymphoma	2A80-2A86	Phase 2	[4]
SGN-30	DMJ9M5D	Solid tumour/cancer	2A00-2F9Z	Phase 2	[5]
TT11X	DMW3M7X	Hodgkin lymphoma	2B30	Phase 2	[6]
TT20X	DMHGI09	Aggressive cancer	2A00-2F9Z	Phase 2	[6]
4SCAR19 and 4SCAR30	DMUYFS1	B-cell lymphoma	2A86	Phase 1/2	[7]
Anti-CD30 CAR T cells	DM8139V	Lymphoma	2A80-2A86	Phase 1/2	[8]
Anti-CD30-CAR-transduced T cells	DMTZSPJ	leukaemia	2A60-2B33	Phase 1/2	[9]
CAR.CD30 cells	DM6ZXWY	Immune System disease	4A01-4B41	Phase 1/2	[10]
CART30	DMLE8T9	Hodgkin lymphoma	2B30	Phase 1/2	[11]
Anti-CD30 CAR-T cells	DMTK78L	leukaemia	2A60-2B33	Phase 1	[12]
Anti-CD30-CAR T cells	DM2IEB7	Hodgkin lymphoma	2B30	Phase 1	[13]
ATLCAR.CD30 cells	DMZI4UX	Immune System disease	4A01-4B41	Phase 1	[14]
ATLCAR.CD30.CCR4 cells	DM3IPSX	Immune System disease	4A01-4B41	Phase 1	[14]
CAR CD30 T cells	DM8NLPI	Hodgkin lymphoma	2B30	Phase 1	[15]
CD30 CAR T Cells	DM4VCJA	Hodgkin lymphoma	2B30	Phase 1	[16]
ICAR30 T cells	DM3YZCV	Anaplastic large cell lymphoma	2A90.A	Phase 1	[17]
SGN-CD30C	DMKW10G	Lymphoma	2A80-2A86	Phase 1	[18]
Xmab-2513	DM6V0KY	Lymphoma	2A80-2A86	Phase 1	[19]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ber-H2/saporin	DMXRTFM	N. A.	N. A.	Terminated	[20]

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
H22xKi-4	DMOJI0N	Discovery agent	N.A.	Investigative	[21]
VT-362	DMG1Q0W	Autoimmune diabetes	5A10	Investigative	[22]

References

• [1] 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
• [2] Clinical pipeline report, company report or official report of Affimed Therapeutics.
• [3] ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
• [4] Utilizing CD30 expression as a rational target for therapy of lymphoma. J Hematol Oncol. 2012; 5(Suppl 1): A2.
• [5] The anti-CD30 monoclonal antibody SGN-30 promotes growth arrest and DNA fragmentation in vitro and affects antitumor activity in models of Hodgkin's disease. Cancer Res. 2002 Jul 1;62(13):3736-42.
• [6] Clinical pipeline report, company report or official report of Tessa Therapeutics
• [7] ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies
• [8] ClinicalTrials.gov (NCT02274584) CAR T Cells Targeting CD30 Positive Lymphomas (4SCAR30273)
• [9] ClinicalTrials.gov (NCT02958410) A Clinical Research of CD30-Targeted CAR-T in Lymphocyte Malignancies
• [10] ClinicalTrials.gov (NCT02663297) Administration of T Lymphocytes for Prevention of Relapse of Lymphomas
• [11] ClinicalTrials.gov (NCT02259556) CD30-directed Chimeric Antigen Receptor T (CART30) Therapy in Relapsed and Refractory CD30 Positive Lymphomas
• [12] ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
• [13] ClinicalTrials.gov (NCT03049449) T Cells Expressing a Fully-Human Anti-CD30 Chimeric Antigen Receptor for Treating CD30-Expressing Lymphomas
• [14] ClinicalTrials.gov (NCT03602157) Study of CAR-T Cells Expressing CD30 and CCR4 for r/r CD30+ HL and NHL
• [15] ClinicalTrials.gov (NCT01316146) Administration of T Lymphocytes for Hodgkin's Lymphoma and Non-Hodgkin's Lymphoma (CART CD30)
• [16] ClinicalTrials.gov (NCT02917083) CD30 CAR T Cells, Relapsed CD30 Expressing Lymphoma (RELY-30)
• [17] ClinicalTrials.gov (NCT03383965) CD30 Targeted CAR-T in Treating CD30-Expressing Lymphomas
• [18] Clinical pipeline report, company report or official report of Seagen.
• [19] Phase I study of an anti-CD30 Fc engineered humanized monoclonal antibody in Hodgkin lymphoma (HL) or anaplastic large cell lymphoma (ALCL) patients: Safety, pharmacokinetics (PK), immunogenicity, and efficacy. J Clin Oncol (Meeting Abstracts) May 2009 vol. 27 no. 15S 8531.
• [20] Antitumor activity of anti-CD30 immunotoxin (Ber-H2/saporin) in vitro and in severe combined immunodeficiency disease mice xenografted with human CD30+ anaplastic large-cell lymphoma. Blood. 1995 Apr15;85(8):2139-46.
• [21] Phase 1 trial of the novel bispecific molecule H22xKi-4 in patients with refractory Hodgkin lymphoma. Blood. 2002 Nov 1;100(9):3101-7.
• [22] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1877).