Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT2IYXF)
DTT Name | L-selectin (SELL) | ||||
---|---|---|---|---|---|
Synonyms | TQ1; SELL; Lymph node homing receptor; Leukocyte-endothelial cell adhesion molecule 1; Leukocyte surface antigen Leu-8; Leukocyte adhesion molecule-1; LECAM1; LAM-1; Gp90-MEL; CD62L | ||||
Gene Name | SELL | ||||
DTT Type |
Clinical trial target
|
[1] | |||
Related Disease |
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN
YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK GKKSKRSMNDPY |
||||
Function |
Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
2 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
2 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||
Molecular Expression Atlas (MEA) of This DTT
References
1 | Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890. | ||||
---|---|---|---|---|---|
2 | GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 Sep 9;116(10):1779-86. | ||||
3 | GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 September 9; 116(10): 1779-1786. | ||||
4 | Rational design of novel, potent small molecule pan-selectin antagonists. J Med Chem. 2007 Mar 22;50(6):1101-15. | ||||
5 | Clinical pipeline report, company report or official report of glycomimetics. | ||||
6 | Therapeutic applications of aptamers. Expert Opin Investig Drugs. 2008 Jan;17(1):43-60. | ||||