Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT2IYXF)

DTT Name	L-selectin (SELL)
Synonyms	TQ1; SELL; Lymph node homing receptor; Leukocyte-endothelial cell adhesion molecule 1; Leukocyte surface antigen Leu-8; Leukocyte adhesion molecule-1; LECAM1; LAM-1; Gp90-MEL; CD62L
Gene Name	SELL
DTT Type	Clinical trial target	[1]
Related Disease	Asthma [ICD-11: CA23] Circulatory system disease [ICD-11: BE2Z]
UniProt ID	LYAM1_HUMAN
TTD ID	T60526
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK GKKSKRSMNDPY
Function	Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
KEGG Pathway	( )
Reactome Pathway	Cell surface interactions at the vascular wall (R-HSA-202733 ) Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GMI-1070	DMJ432G	Asthma	CA23	Phase 3	[1], [2], [3]
BAICALEIN	DM4C7E6	Influenza virus infection	1E30-1E32	Phase 2	[4]
------------------------------------------------------------------------------------

2 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Hu Dreg 55	DMK1VHF	Psoriasis vulgaris	EA90	Terminated	[5]
PURPUROGALLIN	DM63O4F	N. A.	N. A.	Terminated	[4]
------------------------------------------------------------------------------------

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
2,3,4-trihydroxybenzoic acid	DMWHK35	Discovery agent	N.A.	Investigative	[4]
LD201t1	DMC5XQ6	Inflammation	1A00-CA43.1	Investigative	[6]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	3.40E-07	2.19	1.02
Psoriasis	EA90	Skin	1.86E-36	1.26	2.55
------------------------------------------------------------------------------------

References

1	Deal watch: Pfizer deal for selectin inhibitor highlights potential of glycomimetic drugs. Nat Rev Drug Discov. 2011 Dec 1;10(12):890.
2	GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 Sep 9;116(10):1779-86.
3	GMI-1070, a novel pan-selectin antagonist, reverses acute vascular occlusions in sickle cell mice. Blood. 2010 September 9; 116(10): 1779-1786.
4	Rational design of novel, potent small molecule pan-selectin antagonists. J Med Chem. 2007 Mar 22;50(6):1101-15.
5	Clinical pipeline report, company report or official report of glycomimetics.
6	Therapeutic applications of aptamers. Expert Opin Investig Drugs. 2008 Jan;17(1):43-60.