Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT2KHSC)
| DTT Name | Small nuclear ribonuclear CaSm (LSM1) | ||||
|---|---|---|---|---|---|
| Synonyms | LSM1; Cancer-associated Sm-like (CaSm) oncogene; Cancer-associated Sm-like; CaSm | ||||
| Gene Name | LSM1 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIP
RGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDR GLSIPRADTLDEY |
||||
| Function | Plays a role in replication-dependenthistone mRNA degradation. Binds specifically to the 3'-terminal U-tract of U6 snRNA. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||