Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT2XAZY)

• DTT Name: Liver and activation-regulated chemokine (CCL20)
• Synonyms: Smallinducible cytokine A20; Small-inducible cytokine A20; SCYA20; Macrophage inflammatory protein 3 alpha; MIP3alpha; MIP3A; MIP-3-alpha; Liver and activationregulated chemokine; LARC; CCL20(270); CC motif chemokine 20; CC chemokine LARC; C-C motif chemokine 20; Betachemokine exodus1; Beta-chemokine exodus-1
• Gene Name: CCL20
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine: CC chemokine
• UniProt ID: CCL20_HUMAN
• TTD ID: T04894
• Sequence:
  MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI
  NAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
• Function: Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. Possesses antibacterial activity towards E. coli ATCC 25922 and S. aureus ATCC 29213. Acts as a ligand for C-C chemokine receptor CCR6.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine signaling pathway (hsa04062)
  IL-17 signaling pathway (hsa04657)
  TNF signaling pathway (hsa04668)
  Rheumatoid arthritis (hsa05323)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Interleukin-10 signaling (R-HSA-6783783)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GSK3050002	DM4ZK6G	Psoriatic arthritis	FA21	Phase 1	[1]

References

• [1] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)