Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT2Z83I)
| DTT Name | Annexin A5 (ANXA5) | ||||
|---|---|---|---|---|---|
| Synonyms |
Vascular anticoagulantalpha; Vascular anticoagulant-alpha; VACalpha; VAC-alpha; Thromboplastin inhibitor; Placental anticoagulant protein I; Placental anticoagulant protein 4; PP4; PAPI; PAP-I; Lipocortin V; Endonexin II; ENX2; Calphobindin I; CBPI; CBP-I; Annexin5; Annexin-5; Annexin V; Anchorin CII; ANX5
|
||||
| Gene Name | ANXA5 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
Annexin protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTL
FGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE ELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALF QAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAV VKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMI KGDTSGDYKKALLLLCGEDD |
||||
| Function | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||