Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT369M5)

• DTT Name: Protein-tyrosine phosphatase SHP-1 (PTPN6)
• Synonyms: Tyrosine-protein phosphatase non-receptor type 6; SH-PTP1; Protein-tyrosine phosphatase 1C; PTP1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; HCP
• Gene Name: PTPN6
• DTT Type: Patented-recorded target; [1]
• BioChemical Class: Phosphoric monoester hydrolase
• UniProt ID: PTN6_HUMAN
• TTD ID: T98264
• EC Number: EC 3.1.3.48
• Sequence:
  MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
  YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
  ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
  LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
  KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
  YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
  CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
  GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
  DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
  YPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
• Function: The SH2 regions may interact with other cellular components to modulate its own phosphatase activity against interacting substrates. Together with MTUS1, induces UBE2V2 expression upon angiotensin II stimulation. Plays a key role in hematopoiesis. Modulates signaling by tyrosine phosphorylated cell surface receptors such as KIT and the EGF receptor/EGFR.
• KEGG Pathway:
  Adherens junction (hsa04520)
  JAK-STAT signaling pathway (hsa04630)
  Natural killer cell mediated cytotoxicity (hsa04650)
  T cell receptor signaling pathway (hsa04660)
  B cell receptor signaling pathway (hsa04662)
  Pathogenic Escherichia coli infection (hsa05130)
  Leishmaniasis (hsa05140)
  Proteoglycans in cancer (hsa05205)
  PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235)
• Reactome Pathway:
  Regulation of KIT signaling (R-HSA-1433559)
  Signaling by ALK (R-HSA-201556)
  PECAM1 interactions (R-HSA-210990)
  Costimulation by the CD28 family (R-HSA-388841)
  PD-1 signaling (R-HSA-389948)
  Signal regulatory protein family interactions (R-HSA-391160)
  Platelet sensitization by LDL (R-HSA-432142)
  Interleukin-3, Interleukin-5 and GM-CSF signaling (R-HSA-512988)
  CD22 mediated BCR regulation (R-HSA-5690714)
  Neutrophil degranulation (R-HSA-6798695)
  Interferon gamma signaling (R-HSA-877300)
  Regulation of IFNG signaling (R-HSA-877312)
  Interleukin-37 signaling (R-HSA-9008059)
  Interferon alpha/beta signaling (R-HSA-909733)
  Interleukin receptor SHC signaling (R-HSA-912526)
  Regulation of IFNA/IFNB signaling (R-HSA-912694)
  SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671)
  Growth hormone receptor signaling (R-HSA-982772)
  Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695)
  GPVI-mediated activation cascade (R-HSA-114604)

Molecular Interaction Atlas (MIA) of This DTT

2 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BDBM50054344	DMA7JB6	N. A.	N. A.	Patented	[2]
NSC-87877	DMEYKXL	Discovery agent	N.A.	Patented	[3]

References

• [1] Biomarkers in psoriasis and psoriatic arthritis. Ann Rheum Dis. 2013 Apr;72 Suppl 2:ii104-10.
• [2] Hydroxyindole carboxylic acid based inhibitors for oncogenic Src homology-2 domain containing protein tyrosine phosphatase-2 (SHP2). US9522881.
• [3] Inhibition of Shp2/PTPN11 protein tyrosine phosphatase by NSC-87877, NSC-117199 and their analogs. US8987474.