Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT38MDJ)

DTT Name	Tissue factor (F3)
Synonyms	Thromboplastin; TF; F3; Coagulation factor III; CD142 antigen
Gene Name	F3
DTT Type	Clinical trial target	[1]
UniProt ID	TF_HUMAN
TTD ID	T72702
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS
Function	Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assemblyand propagation of the coagulation protease cascade.
KEGG Pathway	Complement and coagulation cascades (hsa04610 )
Reactome Pathway	Extrinsic Pathway of Fibrin Clot Formation (R-HSA-140834 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Tisotumab vedotin	DMF8FK3	Cervical cancer	2C77.0	Approved	[2]
------------------------------------------------------------------------------------

3 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ALT-836	DMGJ71F	Adult respiratory distress syndrome	CB00	Phase 2	[3]
TT-173	DMSIXG4	Bleeding disorder	GA20-GA21	Phase 2	[1]
MORAb-066	DMTUKW9	Pancreatic cancer	2C10	Phase 1	[4]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
D-Pro-Phe-Arg chloromethyl ketone	DMRJQ8X	Discovery agent	N.A.	Investigative	[5]
------------------------------------------------------------------------------------

References

1	TETIS study: evaluation of new topical hemostatic agent TT-173 in tooth extraction. Clin Oral Investig. 2016 Jun;20(5):1055-63.
2	FDA Approved Drug Products from FDA Official Website. 2021. Application Number: 761208.
3	ImmunoPET of tissue factor expression in triple-negative breast cancer with a radiolabeled antibody Fab fragment. Eur J Nucl Med Mol Imaging. 2015 Jul;42(8):1295-303.
4	Clinical pipeline report, company report or official report of Morphotek.
5	Novel 3-carboxamide-coumarins as potent and selective FXIIa inhibitors. J Med Chem. 2008 Jun 12;51(11):3077-80.