Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT390KA)
DTT Name | Geminin (GMNN) | ||||
---|---|---|---|---|---|
Synonyms | geminin DNA replication inhibitor; MGORS6 | ||||
Gene Name | GMNN | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTS
TTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKL HKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEET VEDSLVEDSEIGTCAEGTVSSSTDAKPCI |
||||
Function |
It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle. Inhibits DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC).
|
||||
Reactome Pathway | |||||