Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT3PTB6)
DTT Name | Translationally-controlled tumor protein (TPT1) | ||||
---|---|---|---|---|---|
Synonyms | p23; TPT1; TCTP; Histamine-releasing factor; HRF; Fortilin | ||||
Gene Name | TPT1 | ||||
DTT Type |
Discontinued target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGE
GTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAE QIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC |
||||
Function | Involved in calcium binding and microtubule stabilization. | ||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Discontinued Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||