Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT3TGLR)
| DTT Name | Heart lipid-binding protein | ||||
|---|---|---|---|---|---|
| Synonyms | Fatty acid-binding protein 3; H-FABP; Heart-type fatty acid-binding protein; M-FABP; MDGI; Mammary-derived growth inhibitor; Muscle fatty acid-binding protein; Fatty acid-binding protein, heart; FABP3 | ||||
| Gene Name | FABP3 | ||||
| BioChemical Class |
Single Protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH GTAVCTRTYEKEA |
||||
| Function | FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. | ||||