Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT48Z3K)

• DTT Name: GSTP1 messenger RNA (GSTP1 mRNA)
• Synonyms: GST class-pi; GSTP1-1
• Gene Name: GSTP1
• DTT Type: Clinical trial target; [1]
• UniProt ID: GSTP1_HUMAN
• TTD ID: T47381
• EC Number: EC 2.5.1.18
• Sequence:
  MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
  LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
  KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
  VGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
• KEGG Pathway:
  Glutathione metabolism (hsa00480)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Drug metabolism - cytochrome P450 (hsa00982)
  Drug metabolism - other enzymes (hsa00983)
  Metabolic pathways (hsa01100)
  Platinum drug resistance (hsa01524)
  Pathways in cancer (hsa05200)
  Chemical carcinogenesis - DNA adducts (hsa05204)
  Prostate cancer (hsa05215)
  Hepatocellular carcinoma (hsa05225)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  Detoxification of Reactive Oxygen Species (R-HSA-3299685)
  Neutrophil degranulation (R-HSA-6798695)
  Paracetamol ADME (R-HSA-9753281)
  Glutathione conjugation (R-HSA-156590)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NBF-006	DMG0SWE	Colorectal cancer	2B91.Z	Phase 1	[1]

References

• [1] Clinical pipeline report, company report or official report of Nitto Biopharma.