Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT4G2JS)

• DTT Name: Voltage-gated sodium channel alpha Nav1.7 (SCN9A)
• Synonyms: hNE-Na; Voltage-gated sodium channel subunit alpha Nav1.7; Sodium channel proteintype IX subunit alpha; Sodium channel proteintype 9 subunit alpha; Sodium channel protein type IX subunit alpha; Sodium channel protein type 9 subunit alpha; Peripheral sodium channel 1; PN1; Neuroendocrine sodium channel; NENA
• Gene Name: SCN9A
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Voltage-gated ion channel
• UniProt ID: SCN9A_HUMAN
• TTD ID: T12119
• Sequence:
  MAMLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPKEEKKDDDEEAPKPSSDLEAGKQLP
  FIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISI
  KILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGE
  FTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQ
  SVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFR
  KYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQ
  DYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKE
  LEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRNRR
  KKKNQKKLSSGEEKGDAEKLSKSESEDSIRRKSFHLGVEGHRRAHEKRLSTPNQSPLSIR
  GSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSLFVPHRPQERRSS
  NISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDSGT
  TNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHK
  FLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGN
  LVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLL
  RVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIN
  DDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVL
  NLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKI
  SREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFI
  HNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEE
  AEAEPMNSDEPEACFTDGCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVL
  MILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCW
  LDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPS
  IMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNV
  RWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVF
  IIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRP
  GNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTG
  ECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRI
  LRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFN
  FETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYF
  VSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFS
  KLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLR
  SQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKDG
  DRDDDLLNKKDMAFDNVNENSSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKEDKG
  KDSKESKK
• Function: Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain. Mediates the voltage-dependent sodium ion permeability of excitable membranes.
• KEGG Pathway: Taste transduction (hsa04742)
• Reactome Pathway: Interaction between L1 and Ankyrins (R-HSA-445095)

Molecular Interaction Atlas (MIA) of This DTT

12 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
BIIB074	DMLV1ET	Bipolar disorder	6A60	Phase 2	[2]
PF-05089771	DMD74BJ	Chronic pain	MG30	Phase 2	[3]
XEN-402	DMR69CG	Osteoarthritis	FA00-FA05	Phase 2	[1]
BIIB095	DMUC6EP	Pain	MG30-MG3Z	Phase 1	[2]
CC8464	DMILHMC	Neuropathic pain	8E43.0	Phase 1	[2]
DSP-2230	DM0WTMD	Neuropathic pain	8E43.0	Phase 1	[2]
DSP-3905	DMYHU24	Neuropathic pain	8E43.0	Phase 1	[2]
DWJ-208	DMQKDJZ	Cancer related pain	MG30	Phase 1	[2]
GDC0310	DMUNFEP	Chronic pain	MG30	Phase 1	[4]
PF-05186462	DMUF6W9	Pain	MG30-MG3Z	Phase 1	[5]
PF-05241328	DM2NTBL	Pain	MG30-MG3Z	Phase 1	[6]
RG7893	DM1R4MQ	Pain	MG30-MG3Z	Phase 1	[7]

19 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Aryl carboxamide derivative 1	DMTZRCW	N. A.	N. A.	Patented	[8]
Aryl carboxamide derivative 2	DM146TA	N. A.	N. A.	Patented	[8]
Aryl carboxamide derivative 4	DMNBW8P	N. A.	N. A.	Patented	[8]
Benzene sulfonamide derivative 11	DML9TF7	N. A.	N. A.	Patented	[8]
Benzene sulfonamide derivative 12	DMESKY1	N. A.	N. A.	Patented	[8]
Benzene sulfonamide derivative 15	DMFJTE9	N. A.	N. A.	Patented	[8]
Benzene sulfonamide derivative 9	DMLET14	N. A.	N. A.	Patented	[8]
Cyclopropyl-spiro piperidine derivative 1	DM0YTGS	N. A.	N. A.	Patented	[8]
Cyclopropyl-spiro piperidine derivative 2	DMM0R65	N. A.	N. A.	Patented	[8]
Cyclopropyl-spiro piperidine derivative 3	DM0IZW8	N. A.	N. A.	Patented	[8]
Cyclopropyl-spiro piperidine derivative 4	DM2ZWSM	N. A.	N. A.	Patented	[8]
Dihydrobenzoxazine and tetrahydroquinoxaline sulfonamide derivative 1	DMUNFAT	N. A.	N. A.	Patented	[8]
Enzoxazolinone sulfonamide derivative 1	DMJSIN8	N. A.	N. A.	Patented	[8]
Methylsulfonylbenzamide derivative 2	DMHVZ4M	N. A.	N. A.	Patented	[8]
Pyrimidine derivative 1	DMN9VQM	N. A.	N. A.	Patented	[8]
Pyrrolo-benzo-diazine derivative 1	DMS4I6B	N. A.	N. A.	Patented	[8]
Pyrrolo-pyridinone derivative 5	DMK2FSY	N. A.	N. A.	Patented	[8]
Pyrrolo-pyridinone derivative 6	DMXGNP8	N. A.	N. A.	Patented	[8]
Tarizine derivative 1	DMK5HAC	N. A.	N. A.	Patented	[8]

3 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Corus 1030	DMRVJ1A	Asthma	CA23	Discontinued in Phase 2	[9]
SIPATRIGINE	DMMQ4GC	Neurological disorder	6B60	Discontinued in Phase 2	[10]
V-102862	DMR2EUV	N. A.	N. A.	Discontinued in Phase 1	[11]

8 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
4-(2'-(trifluoromethoxy)biphenyl-3-yl)oxazole	DMIL45X	Discovery agent	N.A.	Investigative	[11]
4-(2'-(trifluoromethoxy)biphenyl-3-yl)thiazole	DM3R2D1	Discovery agent	N.A.	Investigative	[11]
4-(2'-(trifluoromethyl)biphenyl-3-yl)oxazole	DMXC5S0	Discovery agent	N.A.	Investigative	[11]
batrachotoxin	DMYH9SU	Discovery agent	N.A.	Investigative	[12]
N-Me-aminopyrimidinone 9	DMM731A	Discovery agent	N.A.	Investigative	[13]
pyrrolopyrimidine 48	DMUEKB3	Discovery agent	N.A.	Investigative	[14]
veratridine	DMUF8JZ	Discovery agent	N.A.	Investigative	[12]
XEN-907	DMZ24P1	Pain	MG30-MG3Z	Investigative	[12]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	1.42E-03	-0.12	-0.36

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Voltage-gated sodium channel alpha Nav1.7 (SCN9A) DTP Info
• Gene Name: SCN9A

References

• [1] Treatment of Na(v)1.7-mediated pain in inherited erythromelalgia using a novel sodium channel blocker. Pain. 2012 Jan;153(1):80-5.
• [2] Antibodies and venom peptides: new modalities for ion channels. Nat Rev Drug Discov. 2019 May;18(5):339-357.
• [3] Primary erythromelalgia: a review. Orphanet J Rare Dis. 2015 Sep 30;10:127.
• [4] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [5] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026875)
• [6] Recent progress in sodium channel modulators for pain. Bioorg Med Chem Lett. 2014 Aug 15;24(16):3690-9.
• [7] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800041740)
• [8] Sodium channel blockers: a patent review (2010 - 2014).Expert Opin Ther Pat. 2015 Mar;25(3):279-90.
• [9] Differential modulation of Nav1.7 and Nav1.8 peripheral nerve sodium channels by the local anesthetic lidocaine. Br J Pharmacol. 2004 Jun;142(3):576-84.
• [10] Oxadiazolylindazole sodium channel modulators are neuroprotective toward hippocampal neurones. J Med Chem. 2009 May 14;52(9):2694-707.
• [11] Substituted biaryl oxazoles, imidazoles, and thiazoles as sodium channel blockers. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5536-40.
• [12] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 584).
• [13] Discovery and optimization of aminopyrimidinones as potent and state-dependent Nav1.7 antagonists. Bioorg Med Chem Lett. 2012 Jan 15;22(2):1055-60.
• [14] Discovery and hit-to-lead optimization of pyrrolopyrimidines as potent, state-dependent Na(v)1.7 antagonists. Bioorg Med Chem Lett. 2012 Mar 1;22(5):2052-62.