Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT4LRVO)
DTT Name | Gastrin (GAST) | ||||
---|---|---|---|---|---|
Synonyms | Gastrin6; GAST; G52; G34; G14 | ||||
Gene Name | GAST | ||||
DTT Type |
Clinical trial target
|
[1] | |||
BioChemical Class |
Gastrin cholecystokinin
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN |
||||
Function |
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
|
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||