Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5B8AX)

DTT Name Mycobacterium Thymidine monophosphate kinase (MycB tmk)
Synonyms tmk; Thymidylic kinase; Thymidylic acid kinase; Thymidylate monophosphate kinase; Thymidylate kinase; Thymidine 5'-monophosphate kinase; TMPK; Deoxythymidine 5'-monophosphate kinase; DTMPkinase
Gene Name MycB tmk
DTT Type
Literature-reported target
 [1]
BioChemical Class
Kinase
UniProt ID
KTHY_MYCTU
TTD ID
T94400
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
EC 2.7.4.9
Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
Function
Catalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth. Has a broad specificity for nucleoside triphosphates, being highly active withATP or dATP as phosphate donors, and less active with ITP, GTP, CTP and UTP.
KEGG Pathway
( )
( )
BioCyc Pathway
MetaCyc:G185E-7521-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
14 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
2',3'-Dideoxythymidine-5'-Monophosphate DMEQXUD Discovery agent N.A. Investigative [2]
2'-deoxythymidine triphosphate DM9OEJT Discovery agent N.A. Investigative [2]
3'-Azido-3'-Deoxythymidine-5'-Monophosphate DMU08MN Discovery agent N.A. Investigative [2]
5'-amino-5'-deoxy-alpha-D-thymidine DMBF42W Discovery agent N.A. Investigative [3]
5'-deoxythymidine DMR48NG Discovery agent N.A. Investigative [1]
5-Hydroxymethyluridine-2'-Deoxy-5'-Monophosphate DMWVCJ1 Discovery agent N.A. Investigative [2]
Acetate Ion DMD08RH Discovery agent N.A. Investigative [2]
AMP-PNP DMTOK1D Discovery agent N.A. Investigative [4]
BROMODEOXYURIDINE DM0D7LA Discovery agent N.A. Investigative [5]
CHLORODEOXYURIDINE DMQT3WJ Discovery agent N.A. Investigative [5]
Deoxythymidine DMR90HY Discovery agent N.A. Investigative [2]
Diphosphate DMHY30B Discovery agent N.A. Investigative [2]
P1-(5'-Adenosyl)P5-(5'-Thymidyl)Pentaphosphate DMM4VWD Discovery agent N.A. Investigative [6]
Thymidine-5'-Phosphate DMKM6NQ Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Investigative Drug(s)

References

1 Thymidylate kinase as target enzyme for 5'-deoxythymidine and various 5'-deoxy-5'-halogeno pyrimidine nucleosides. Acta Biol Med Ger. 1969;23(6):Suppl:K 19+.
2 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
3 Rational design of 5'-thiourea-substituted alpha-thymidine analogues as thymidine monophosphate kinase inhibitors capable of inhibiting mycobacteri... J Med Chem. 2007 Nov 1;50(22):5281-92.
4 The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
5 Substituted benzyl-pyrimidines targeting thymidine monophosphate kinase of Mycobacterium tuberculosis: synthesis and in vitro anti-mycobacterial ac... Bioorg Med Chem. 2008 Jun 1;16(11):6075-85.
6 DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.