Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT5GKHN)
DTT Name | Lymphocyte antigen 6K (LY6K) | ||||
---|---|---|---|---|---|
Synonyms | Ly-6K; CO16 | ||||
Gene Name | LY6K | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRC
KWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRY CNLEGPPINSSVFKEYAGSMGESCGGLWLAILLLLASIAAGLSLS |
||||
Function | Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth. | ||||
Reactome Pathway | |||||