Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5H2F0)

• DTT Name: Syndecan-2 (SDC2)
• Synonyms: SYND2; Heparan sulfate proteoglycan core protein; HSPG1; HSPG; Fibroglycan; CD362
• Gene Name: SDC2
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Peptide translocating syndecan
• UniProt ID: SDC2_HUMAN
• TTD ID: T80848
• Sequence:
  MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
  EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
  MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
  LGERKPSSAAYQKAPTKEFYA
• Function: Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).
• KEGG Pathway:
  Cell adhesion molecules (hsa04514)
  Malaria (hsa05144)
  Proteoglycans in cancer (hsa05205)
  Fluid shear stress and atherosclerosis (hsa05418)
• Reactome Pathway:
  HS-GAG biosynthesis (R-HSA-2022928)
  HS-GAG degradation (R-HSA-2024096)
  Cell surface interactions at the vascular wall (R-HSA-202733)
  Syndecan interactions (R-HSA-3000170)
  Defective B4GALT7 causes EDS, progeroid type (R-HSA-3560783)
  Defective B3GAT3 causes JDSSDHD (R-HSA-3560801)
  Defective EXT2 causes exostoses 2 (R-HSA-3656237)
  Defective EXT1 causes exostoses 1, TRPS2 and CHDS (R-HSA-3656253)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  EPHB-mediated forward signaling (R-HSA-3928662)
  Defective B3GALT6 causes EDSP2 and SEMDJL1 (R-HSA-4420332)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Attachment and Entry (R-HSA-9694614)
  Retinoid metabolism and transport (R-HSA-975634)
  A tetrasaccharide linker sequence is required for GAG synthesis (R-HSA-1971475)

References

• [1] Emerging roles of syndecan 2 in epithelial and mesenchymal cancer progression. IUBMB Life. 2017 Nov;69(11):824-833.