Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT5HNVS)
| DTT Name | Melanoma derived growth regulator (MIA) | ||||
|---|---|---|---|---|---|
| Synonyms | Melanoma-derived growth regulatory protein; Melanoma inhibitory activity protein | ||||
| Gene Name | MIA | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCR
FLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVD VKTDKWDFYCQ |
||||
| Function | Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas. | ||||