Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5IP87)

DTT Name	Heat shock protein 20 (HSP20)
Synonyms	Stress-responsive protein 27; SRP27; HspB1; Heat shock protein beta-1; Heat shock 27 kDa protein; HSP28; HSP27; HSP 27; Estrogen-regulated 24 kDa protein; 28 kDa heat shock protein
Gene Name	HSPB1
DTT Type	Clinical trial target	[1]
BioChemical Class	Heat shock protein
UniProt ID	HSPB1_HUMAN
TTD ID	T39921
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT IPVTFESRAQLGGPEAAKSDETAAK
Function	Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins.
KEGG Pathway	MAPK signaling pathway (hsa04010 ) VEGF signaling pathway (hsa04370 ) Amoebiasis (hsa05146 )
Reactome Pathway	AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408 ) MAPK6/MAPK4 signaling (R-HSA-5687128 ) Extra-nuclear estrogen signaling (R-HSA-9009391 ) VEGFA-VEGFR2 Pathway (R-HSA-4420097 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AZX-100	DME0JMV	Asthma	CA23	Phase 2	[1]
------------------------------------------------------------------------------------

References

1	Internalization and intracellular trafficking of a PTD-conjugated anti-fibrotic peptide, AZX100, in human dermal keloid fibroblasts. J Pharm Sci. 2010 Jul;99(7):3100-21.