Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT5KSBY)

• DTT Name: Surface glycoprotein LFA-3 (CD58)
• Synonyms: Surface glycoprotein LFA3; Lymphocyte functionassociated antigen 3; Lymphocyte function-associated antigen 3; LFA3; Ag3
• Gene Name: CD58
• DTT Type: Successful target; [1]
• UniProt ID: LFA3_HUMAN
• TTD ID: T59122
• Sequence:
  MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQK
  DKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYV
  LESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMEND
  LPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKC
  DRKPDRTNSN
• Function: Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
• KEGG Pathway:
  Cell adhesion molecules (hsa04514)
  Epstein-Barr virus infection (hsa05169)
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alefacept	DMMYPWO	Pain	MG30-MG3Z	Approved	[1]

References

• [1] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.