General Information of Drug Therapeutic Target (DTT) (ID: TT5Y4EM)

DTT Name N-formyl peptide receptor (FPR1)
Synonyms N-formylpeptide chemoattractant receptor; FPR1; FPR
Gene Name FPR1
DTT Type
Clinical trial target
[1]
BioChemical Class
GPCR rhodopsin
UniProt ID
FPR1_HUMAN
TTD ID
T87831
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Function
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors (PubMed:2161213, PubMed:2176894, PubMed:10514456, PubMed:15153520). Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release (PubMed:2161213, PubMed:1712023, PubMed:15153520). This response is mediated via a G-protein that activates a phosphatidylinositol- calcium second messenger system(PubMed:1712023, PubMed:10514456).
KEGG Pathway
Rap1 signaling pathway (hsa04015 )
Neuroactive ligand-receptor interaction (hsa04080 )
Staphylococcus aureus infection (hsa05150 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Rebamipide DM2GHCR Peptic ulcer DA61 Phase 3 [1]
------------------------------------------------------------------------------------
12 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
3570-0208 DMT80IF Discovery agent N.A. Investigative [2]
AG-09/1 DMW7H28 Discovery agent N.A. Investigative [3]
AG-11/03 DMZINUY Discovery agent N.A. Investigative [4]
AG-14 DMVR9G0 Discovery agent N.A. Investigative [5]
BVT173187 DMULZOP Discovery agent N.A. Investigative [6]
CGEN-855 DM4FMPJ Inflammation 1A00-CA43.1 Investigative [7]
diamide 7 DM4EX8Y Discovery agent N.A. Investigative [8]
fMet-Leu-Phe DMQ391A N. A. N. A. Investigative [9]
group E 1682-2106 DMO6IM1 Discovery agent N.A. Investigative [10]
methionine benzimidazole 6 DMEIP6H Discovery agent N.A. Investigative [8]
PMID22607879CR-(-)-5f DM7OJ5Q Discovery agent N.A. Investigative [11]
pyrazolone, 1 DMLFQKU Discovery agent N.A. Investigative [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Investigative Drug(s)

References

1 Rebamipide suppresses formyl-methionyl-leucyl-phenylalanine (fMLP)-induced superoxide production by inhibiting fMLP-receptor binding in human neutrophils. J Pharmacol Exp Ther. 2001 Apr;297(1):388-94.
2 Discovery of selective probes and antagonists for G-protein-coupled receptors FPR/FPRL1 and GPR30. Curr Top Med Chem. 2009;9(13):1227-36.
3 Identification of novel small-molecule agonists for human formyl peptide receptors and pharmacophore models of their recognition. Mol Pharmacol. 2010 Feb;77(2):159-70.
4 Molecular docking of 2-(benzimidazol-2-ylthio)-N-phenylacetamide-derived small-molecule agonists of human formyl peptide receptor 1. J Mol Model. 2012 Jun;18(6):2831-43.
5 High-throughput screening for small-molecule activators of neutrophils: identification of novel N-formyl peptide receptor agonists. Mol Pharmacol. 2007 Apr;71(4):1061-74.
6 A non-peptide receptor inhibitor with selectivity for one of the neutrophil formyl peptide receptors, FPR 1. Biochem Pharmacol. 2012 Jun 15;83(12):1655-62.
7 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 222).
8 Discovery of small molecule human FPR1 receptor antagonists. Bioorg Med Chem Lett. 2011 May 15;21(10):2991-7.
9 Further studies on the structural requirements for synthetic peptide chemoattractants. Biochemistry. 1980 May 27;19(11):2404-10.
10 Integration of virtual screening with high-throughput flow cytometry to identify novel small molecule formylpeptide receptor antagonists. Mol Pharmacol. 2005 Nov;68(5):1301-10.
11 Synthesis, enantioresolution, and activity profile of chiral 6-methyl-2,4-disubstituted pyridazin-3(2H)-ones as potent N-formyl peptide receptor agonists. Bioorg Med Chem. 2012 Jun 15;20(12):3781-92.
12 Functional characterization of three mouse formyl peptide receptors. Mol Pharmacol. 2013 Feb;83(2):389-98.