Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT64REZ)
DTT Name | Neuropeptide Y (NPY) | ||||
---|---|---|---|---|---|
Synonyms | Pro-neuropeptide Y | ||||
Gene Name | NPY | ||||
DTT Type |
Literature-reported target
|
[1] | |||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
||||
Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||