Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT6F7GZ)

DTT Name	Parathyroid hormone (PTH)
Synonyms	Parathyrin; Parathormone
Gene Name	PTH
DTT Type	Successful target	[1]
UniProt ID	PTHY_HUMAN
TTD ID	T98708
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Function	Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion.
KEGG Pathway	Neuroactive ligand-receptor interaction (hsa04080 ) Parathyroid hormone synthesis, secretion and action (hsa04928 ) Endocrine and other factor-regulated calcium reabsorption (hsa04961 ) Rheumatoid arthritis (hsa05323 )
Reactome Pathway	G alpha (s) signalling events (R-HSA-418555 ) Class B/2 (Secretin family receptors) (R-HSA-373080 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Teriparatide	DMMC45B	Exostosis		Approved	[1]
------------------------------------------------------------------------------------

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
KUR-111	DMZL48U	Bone disease	FC0Z	Phase 2	[2]
Ostabolin-C	DMBVI6E	Osteoporosis	FB83.0	Phase 2	[3]
------------------------------------------------------------------------------------

2 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABX-PTH	DMDPUK6	Parathyroid disease	5A50-5A5Z	Terminated	[4]
SUN-E3001	DMAM3OH	Osteoporosis	FB83.0	Terminated	[5]
------------------------------------------------------------------------------------

2 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MG-1101	DM710KZ	Discovery agent	N.A.	Investigative	[6]
parathyroid hormone	DMKJY3U	Discovery agent	N.A.	Investigative	[6]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Osteoporosis	FA20	Bone marrow	3.70E-01	0.08	0.66
------------------------------------------------------------------------------------

References

1	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
2	Company report (Cytos)
3	ZT-031, a cyclized analog of parathyroid hormone(1-31) for the potential treatment of osteoporosis. IDrugs. 2008 Nov;11(11):827-40.
4	Focus on parathyroid carcinoma. International Journal of Surgery Volume 9, Issue 1, 2011, Pages 13-19.
5	Effects of teriparatide [recombinant human parathyroid hormone (1-34)] on cortical bone in postmenopausal women with osteoporosis. J Bone Miner Res. 2003 Mar;18(3):539-43.
6	Daily parathyroid hormone 1-34 replacement therapy for hypoparathyroidism induces marked changes in bone turnover and structure.J Bone Miner Res.2012 Aug;27(8):1811-20.