Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT6TKEN)

• DTT Name: Gamma-hydroxybutyrate receptor (SLC52A2)
• Synonyms: SLC52A2; Protein GPR172A; PERV-A receptor 1; GPR172A
• Gene Name: SLC52A2
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Eukaryoticriboflavin transporter
• UniProt ID: S52A2_HUMAN
• TTD ID: T52946
• Sequence:
  MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNL
  GLLVVTLWRRLAPGKDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFV
  LALACCASNVTFLPFLSHLPPRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGT
  PGPPLDFLERFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGA
  EEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARSACLLGLLAATNALTNGVLPAVQSF
  SCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCGGYLMALAVLS
  PCPPLVGTSAGVVLVVLSWVLCLGVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGA
  VAMFPPTSIYHVFHSRKDCADPCDS
• Function: Riboflavintransporter. Riboflavin transport is Na(+)- independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin. Weakly inhibited by flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN). In case of infection by retroviruses, acts as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A).
• Reactome Pathway: Vitamin B2 (riboflavin) metabolism (R-HSA-196843)

Molecular Interaction Atlas (MIA) of This DTT

9 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
4-Cyclohexyl-4-hydroxy-but-2-enoic acid	DMTFL5J	Discovery agent	N.A.	Investigative	[1]
4-Hydroxy-3-methyl-but-2-enoic acid	DMWDBHC	Discovery agent	N.A.	Investigative	[1]
4-Hydroxy-3-methyl-butyric acid	DM6AHO4	Discovery agent	N.A.	Investigative	[1]
4-Hydroxy-4-phenyl-but-2-enoic acid	DMIVQGW	Discovery agent	N.A.	Investigative	[1]
4-Hydroxy-4-phenyl-butyric acid	DMDWGS9	Discovery agent	N.A.	Investigative	[1]
4-hydroxy-but-2-enoate	DMCA2XQ	Discovery agent	N.A.	Investigative	[1]
4-Hydroxy-pent-2-enoic acid	DM5ZQK1	Discovery agent	N.A.	Investigative	[1]
4-Hydroxy-pentanoic acid	DMDGKFV	Discovery agent	N.A.	Investigative	[1]
5-hydroxy-pentanoate	DMJQFZH	Discovery agent	N.A.	Investigative	[1]

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Riboflavin transporter 3 (SLC52A2) DTP Info
• Gene Name: SLC52A2

1 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Riboflavin	DM8YMWE	Acne vulgaris	ED80	Approved	[2]

References

• [1] Analogues of gamma-hydroxybutyric acid. Synthesis and binding studies. J Med Chem. 1988 May;31(5):893-7.
• [2] An intronic variation in SLC52A1 causes exon skipping and transient riboflavin-responsive multiple acyl-CoA dehydrogenation deficiency. Mol Genet Metab. 2017 Dec;122(4):182-188.