Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT6Y4PN)

DTT Name	Glucagon-like peptide 1 (GLP-1:7-37)
Synonyms	Glucagon-like peptide-1(7-36)-amide; GLP-1 (92-128); GLP; GCG
Gene Name	GCG
DTT Type	Literature-reported target	[1]
BioChemical Class	Glucagon
UniProt ID	GLUC_HUMAN
TTD ID	T09694
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Function	Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
KEGG Pathway	Insulin secretion (hsa04911 ) Glucagon signaling pathway (hsa04922 )
Reactome Pathway	Glucagon-like Peptide-1 (GLP1) regulates insulin secretion (R-HSA-381676 ) G alpha (q) signalling events (R-HSA-416476 ) G alpha (s) signalling events (R-HSA-418555 ) Glucagon-type ligand receptors (R-HSA-420092 ) Glucagon signaling in metabolic regulation (R-HSA-163359 )

References

1	Promising new approaches to the management of obesity. Drugs. 2000 Jul;60(1):1-9.