Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT70MLA)

• DTT Name: Oncotrophoblast glycoprotein 5T4 (TPBG)
• Synonyms: Trophoblast glycoprotein; TPBG
• Gene Name: TPBG
• DTT Type: Clinical trial target; [1]
• UniProt ID: TPBG_HUMAN
• TTD ID: T09058
• Sequence:
  MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
  QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL
  AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL
  NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD
  LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC
  HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG
  IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV
• Function: May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a- dependent LRP6 internalization.

Molecular Interaction Atlas (MIA) of This DTT

5 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
TroVax	DMHDNK0	Prostate cancer	2C82.0	Phase 3	[1]
Naptumomab estafenatox	DM901ZW	Solid tumour/cancer	2A00-2F9Z	Phase 2/3	[2]
CV-9201	DMCPZYT	Non-small-cell lung cancer	2C25.Y	Phase 1/2	[3]
GEN1044	DMQ9317	Solid tumour/cancer	2A00-2F9Z	Phase 1	[4]
PF-06263507	DM5KBDY	Solid tumour/cancer	2A00-2F9Z	Phase 1	[5]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
IM1240	DMTV0DK	Aggressive cancer	2A00-2F9Z	Preclinical	[6]

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Anatumomab mafenatox	DMMLDG8	Breast cancer	2C60-2C65	Terminated	[7]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Prostate cancer	2C82	Prostate	1.30E-01	0.15	0.17
Lung cancer	2C82	Lung tissue	1.73E-130	1.07	3.46
Breast cancer	2C82	Breast tissue	1.21E-24	0.52	0.82

References

• [1] Vaccination of metastatic renal cancer patients with MVA-5T4: a randomized, double-blind, placebo-controlled phase III study. Clin Cancer Res. 2010 Nov 15;16(22):5539-47.
• [2] Naptumomab estafenatox: targeted immunotherapy with a novel immunotoxin. Curr Oncol Rep. 2014 Feb;16(2):370.
• [3] National Cancer Institute Drug Dictionary (drug id 648549).
• [4] Clinical pipeline report, company report or official report of AbbVie.
• [5] National Cancer Institute Drug Dictionary (drug id 751006).
• [6] Clinical pipeline report, company report or official report of Purple
• [7] A phase II study of a 5T4 oncofoetal antigen tumour-targeted superantigen (ABR-214936) therapy in patients with advanced renal cell carcinoma. Br J Cancer. 2007 Feb 26;96(4):567-74.