Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT75YK4)

• DTT Name: Saccharomyces Cell division control protein 28 (Saccha CDC28)
• Synonyms: YBR160W; YBR1211; SRM5; HSL5; Cyclindependent kinase 1 of Saccharomyces cerevisiae; Cell division protein kinase 1; Cell division control protein 28; CDK1 of Saccharomyces cerevisiae; CDK1; CDC28
• Gene Name: Saccha CDC28
• DTT Type: Literature-reported target; [1]
• BioChemical Class: Kinase
• UniProt ID: CDK1_YEAST
• TTD ID: T37384
• Sequence:
  MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
  LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
  CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
  EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
  YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
• Function: More than 200 substrates have been identified. This protein is essential for the completion of the start, the controlling event, in the cell cycle.
• KEGG Pathway:
  MAPK signaling pathway - yeast (sce04011)
  Cell cycle - yeast (sce04111)
  Meiosis - yeast (sce04113)
• Reactome Pathway:
  Regulation of TP53 Degradation (R-SCE-6804757)
  Orc1 removal from chromatin (R-SCE-68949)
  Activation of the pre-replicative complex (R-SCE-68962)
  CDK-mediated phosphorylation and removal of Cdc6 (R-SCE-69017)
  Cyclin E associated events during G1/S transition (R-SCE-69202)
  Cyclin D associated events in G1 (R-SCE-69231)
  Cyclin A (R-SCE-69656)
  Ubiquitin-dependent degradation of Cyclin D (R-SCE-75815)
  Drug-mediated inhibition of CDK4/CDK6 activity (R-SCE-9754119)
  RMTs methylate histone arginines (R-SCE-3214858)
• BioCyc Pathway: YEAST:G3O-29110-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Borrelidin	DMBSQTR	Discovery agent	N.A.	Investigative	[1]

References

• [1] Borrelidin inhibits a cyclin-dependent kinase (CDK), Cdc28/Cln2, of Saccharomyces cerevisiae. J Antibiot (Tokyo). 2001 Jan;54(1):84-90.