Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7JUKC)
DTT Name | Bcl-2-binding component 3 (BBC3) | ||||
---|---|---|---|---|---|
Synonyms | p53 upregulated modulator of apoptosis; p53 up-regulated modulator of apoptosis; PUMA; JFY1; JFY-1; Bcl2binding component 3 | ||||
Gene Name | BBC3 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
B-cell lymphoma Bcl-2
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLC
APTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPT QAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLP LPRGHRAPEMEPN |
||||
Function |
Functions by promoting partial unfolding of BCL2L1 and dissociation of BCL2L1 from p53/TP53. Regulates ER stress-induced neuronal apoptosis. Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis.
|
||||
KEGG Pathway | |||||
Reactome Pathway |
|
||||