Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7LTUJ)
DTT Name | Fas messenger RNA (FAS mRNA) | ||||
---|---|---|---|---|---|
Synonyms |
Tumor necrosis factor receptor superfamily member 6 (mRNA); TNFRSF6 (mRNA); FASLG receptor (mRNA); FAS1 (mRNA); CD95 (mRNA); Apoptosis-mediating surface antigen FAS (mRNA); Apo-1 antigen (mRNA); APT1 (mRNA)
|
||||
Gene Name | FAS | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
mRNA target
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV |
||||
Function |
The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). Receptor for TNFSF6/FASLG.
|
||||
KEGG Pathway |
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||