Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT7NJSE)

• DTT Name: B-cell-activating factor receptor (TNFRSF13C)
• Synonyms: Tumor necrosis factor receptor superfamily member 13C; CD268; BR3; BLyS receptor 3; BAFFR; BAFF-R; BAFF receptor; B cell-activating factor receptor
• Gene Name: TNFRSF13C
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Cytokine receptor
• UniProt ID: TR13C_HUMAN
• TTD ID: T83687
• Sequence:
  MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
  ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD
  KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG
  PEQQ
• Function: Promotes the survival of mature B-cells and the B-cell response. B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  NF-kappa B signaling pathway (hsa04064)
  Intestinal immune network for IgA production (hsa04672)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Primary immunodeficiency (hsa05340)
• Reactome Pathway:
  TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway (R-HSA-5676594)
  TNFR2 non-canonical NF-kB pathway (R-HSA-5668541)

Molecular Interaction Atlas (MIA) of This DTT

1 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
VAY736	DML2CPW	Pemphigus vulgaris	EB40	Phase 2	[1]

References

• [1] National Cancer Institute Drug Dictionary (drug id 762784).