Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7RUHB)
| DTT Name | Alpha(B)-crystallin | ||||
|---|---|---|---|---|---|
| Synonyms | Renal carcinoma antigen NY-REN-27; Alpha-crystallin B chain; Rosenthal fiber component; Heat shock protein beta-5; HspB5 | ||||
| Gene Name | CRYAB | ||||
| BioChemical Class |
Single Protein
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK |
||||
| Function | May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. | ||||