Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT7W5OT)
| DTT Name | STMN1 messenger RNA (STMN1 mRNA) | ||||
|---|---|---|---|---|---|
| Synonyms |
pp19 (mRNA); pp17 (mRNA); Stathmin (mRNA); Protein Pr22 (mRNA); Prosolin (mRNA); Phosphoprotein p19 (mRNA); Op18 (mRNA); Oncoprotein 18 (mRNA); Metablastin (mRNA); Leukemia-associated phosphoprotein p18 (mRNA); LAP18 (mRNA); C1orf215 (mRNA)
|
||||
| Gene Name | STMN1 | ||||
| DTT Type |
Clinical trial target
|
[1] | |||
| BioChemical Class |
mRNA target
|
||||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL ERLREKDKHIEEVRKNKESKDPADETEAD |
||||
| Function |
Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear. Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Clinical Trial Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||