Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT7WD0H)

DTT Name	Epidermal growth factor-like protein 7 (EGFL7)
Synonyms	ZNEU1; Vascular endothelial statin; VE-statin; UNQ187/PRO1449; NOTCH4-like protein; Multiple epidermal growth factor-like domains protein 7; Multiple epidermal growth factor-like domain protein 7; Multiple EGF-like domains protein 7; Multiple EGF-like domain protein 7; MEGF7; EGF-like protein 7
Gene Name	EGFL7
DTT Type	Clinical trial target	[1]
BioChemical Class	Growth factor
UniProt ID	EGFL7_HUMAN
TTD ID	T40010
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Function	Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis. Regulates vascular tubulogenesis in vivo.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
MEGF0444A	DM2C1YN	Metastatic colorectal cancer	2B91	Phase 2	[1]
Anti-EGFL7	DM0ZDJ5	Non-small-cell lung cancer	2C25.Y	Phase 1	[2]
------------------------------------------------------------------------------------

1 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
RG7414	DMCQRS2	Colorectal cancer	2B91.Z	Discontinued in Phase 2	[3]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rectal cancer	2C82	Rectal colon tissue	2.56E-01	0.07	0.33
Lung cancer	2C82	Lung tissue	6.32E-79	-1.22	-2.22
------------------------------------------------------------------------------------

References

1	A first-in-human phase Ia open-label dose-escalation study of the safety, pharmacokinetics (PK), and pharmacodynamics (PD) of the humanized monoclonal antibody (huMAb) anti-EGFL7 (MEGF0444A) administered intravenously in patients with advanced solid tumors. J Clin Oncol (Meeting Abstracts) May 2011 vol.29 no.15_suppl 2614.
2	Clinical pipeline report, company report or official report of Genentech (2009).
3	Anti-EGFL7 antibodies enhance stress-induced endothelial cell death and anti-VEGF efficacy. J Clin Invest. 2013 September 3; 123(9): 3997-4009.