Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT7YM8D)

DTT Name	Protein tyrosine phosphatase IVA 3 (PRL-3)
Synonyms	Protein-tyrosine phosphatase of regenerating liver 3; Protein-tyrosine phosphatase 4a3; Protein tyrosine phosphatase type IVA 3; PRL3; PRL-3
Gene Name	PTP4A3
DTT Type	Literature-reported target	[1]
BioChemical Class	Phosphoric monoester hydrolase
UniProt ID	TP4A3_HUMAN
TTD ID	T78019
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 3.1.3.48
Sequence	MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
Function	Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. May be involved in the progression of cardiac hypertrophy by inhibiting intracellular calcium mobilization in response to angiotensin II.

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Sodium orthovanadate	DM8CLG2	Discovery agent	N.A.	Investigative	[2]
------------------------------------------------------------------------------------

References

1	Protein-tyrosine phosphatase 4A3 (PTP4A3) promotes vascular endothelial growth factor signaling and enables endothelial cell motility. J Biol Chem. 2014 Feb 28;289(9):5904-13.
2	Structure of human PRL-3, the phosphatase associated with cancer metastasis. FEBS Lett. 2004 May 7;565(1-3):181-7.