Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT87D3J)
| DTT Name | APJ endogenous ligand (Apelin) | ||||
|---|---|---|---|---|---|
| Synonyms | Apelin13; APEL | ||||
| Gene Name | APLN | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF |
||||
| Function |
Drives internalization of the apelin receptor. Apelin-36 dissociates more hardly than (pyroglu)apelin-13 from APLNR. Hormone involved in the regulation of cardiac precursor cell movements during gastrulation and heart morphogenesis. Has an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking; the oral intake of apelin in the colostrum and the milk might therefore modulate immune responses in neonates. Plays a role in early coronary blood vessels formation. Mediates myocardial contractility in an ERK1/2-dependent manner. May also have a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior. Endogenous ligand for the apelin receptor (APLNR).
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||