Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT87RWS)
DTT Name | Interleukin-19 (IL19) | ||||
---|---|---|---|---|---|
Synonyms | ZMDA1; NG.1; Melanoma differentiation-associated protein-like protein; IL-19 | ||||
Gene Name | IL19 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
Cytokine: interleukin
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTIL
STLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ CQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA |
||||
Function | Up-regulates IL-6 and TNF-alpha and induces apoptosis. May play some important roles in inflammatory responses. | ||||
KEGG Pathway | |||||
Reactome Pathway | |||||