Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT89Z17)
DTT Name | B7 translation initiation codon region messenger RNA (CD80 mRNA) | ||||
---|---|---|---|---|---|
Synonyms | T-lymphocyte activation antigen CD80 (mRNA); LAB7 (mRNA); CTLA-4 counter-receptor B7.1 (mRNA); CD28LG1 (mRNA); CD28LG (mRNA); BB1 (mRNA); B7 (mRNA); Activation B7-1 antigen (mRNA) | ||||
Gene Name | CD80 | ||||
DTT Type |
Literature-reported target
|
[1] | |||
BioChemical Class |
mRNA target
|
||||
UniProt ID | |||||
TTD ID | |||||
3D Structure | |||||
Sequence |
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV |
||||
Function |
T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation. Involved in the costimulatory signal essential for T-lymphocyte activation.
|
||||
KEGG Pathway |
|
||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DTT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Investigative Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||||||||